DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and hspa12a.3

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001038346.3 Gene:hspa12a.3 / 559031 ZFINID:ZDB-GENE-030131-8896 Length:571 Species:Danio rerio


Alignment Length:428 Identity:96/428 - (22%)
Similarity:168/428 - (39%) Gaps:98/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FRMEHTVPSDREDQDDRVVT-------KDLSAYQVTVELLRAELELAHQYHTDGEQAPIA----- 155
            |:||   ..|:|...|.::|       |.|:.:..::..|:.......:.:|.|:.. ||     
Zfish    89 FKME---LYDKEIHRDLMITAKNGGQMKALTVFSESLRYLKDHALEKIKENTTGKTF-IASDVTW 149

  Fly   156 VLSIPSYYPASAYKLLADAAQTAGFHVAQ------IITEPTAAVL--------GYSIGEE----Q 202
            ||::|:.:.|:|.:.:.:||..||..:..      ...||.||.:        || |.||    .
Zfish   150 VLTVPAIWNAAAKQFMREAAIEAGLVIESEPERLVFALEPEAASIYCKQLPSEGY-ISEEACRDT 213

  Fly   203 TEQR--RHVLTIKCGGLYSDIAFYS-VQNGLFVQLATFGPFPIGG----RQFTEALVQFICEEFR 260
            .||:  ...:.:.|||...||..:. |::|...:|.......:||    |:|...|.:...|:..
Zfish   214 LEQKPGTQYMVVDCGGGTIDITVHEVVEDGKLKELNAASGNDMGGQTVDRKFISFLKEIFSEKIY 278

  Fly   261 RKYKLD-PHESRRSVAKIRTAAA-------NCKHILTTMPSTQLYIDSLMDGVDYNAQMSRARF- 316
            .|::.| |.|:.:....|..|.:       .|...|..:...:..|:|..:||: .|:...... 
Zfish   279 NKFEQDFPAEALKLKYDIALAKSCDQLVLIQCPVTLQDLAKKEKAIESYFEGVE-GAEWDEGSII 342

  Fly   317 --ESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNS 379
              |..:|...:..::...|.:|:.. .:|.|: |:.::|:|...:...|:..:..||...|:   
Zfish   343 IKEDKLQSFFDESLKTTAEKLEKIM-SNPELN-IEYMLLVGGFAECKILKKFLKERFDKCKI--- 402

  Fly   380 HSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLGRGSVLPAKIR 444
                           ||   |:|.|:      |:.:..:     ......|:|..|.|.|...||
Zfish   403 ---------------VC---PVEPQV------VIIKGAI-----RYAKQPKVVKSRMSALTYGIR 438

  Fly   445 ISLPQSE---EGKGDDVSKAAASF-------KLRTGES 472
            |..|..:   :||...|:....::       .:|.|||
Zfish   439 IDAPFDKVLHKGKTSYVNSEGQTYCDVCFETFVRKGES 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 74/338 (22%)
hspa12a.3NP_001038346.3 HSPA12_like_NBD 6..420 CDD:212671 80/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.