DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7182 and ANKRD45

DIOPT Version :9

Sequence 1:	NP_001286979.1	Gene:	CG7182 / 38944	FlyBaseID:	FBgn0035878	Length:	513	Species:	Drosophila melanogaster
Sequence 2:	XP_016856612.1	Gene:	ANKRD45 / 339416	HGNCID:	24786	Length:	286	Species:	Homo sapiens

Alignment Length:	101	Identity:	24/101 - (23%)
Similarity:	43/101 - (42%)	Gaps:	23/101 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   399 DPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLGRGSVLPAKIRISLPQSEE-GKGDDVSKAA 462
            || |...|::...::.|:|:.   |.:...|..:.|:..|:.|..:..:..:|: .:|..:...|
Human    77 DP-ENPHHEQAMQLLLEEDIV---GRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCA 137

  Fly   463 ASFKLRTGESEILARLPDSTIPEDGLYQLEVEVDVD 498
            |::    |..|.|..|              ||:|||
Human   138 AAW----GRLETLKAL--------------VELDVD 155

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7182	NP_001286979.1	NBD_sugar-kinase_HSP70_actin	5..394	CDD:302596
ANKRD45	XP_016856612.1	ANK repeat	58..94	CDD:293786	5/17 (29%)
		ANK	94..>182	CDD:238125	19/83 (23%)
		Ank_4	97..150	CDD:290365	13/70 (19%)
		ANK repeat	97..127	CDD:293786	6/29 (21%)
		ANK repeat	129..160	CDD:293786	12/45 (27%)
		Ank_4	130..182	CDD:290365	12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0443
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900