DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and CG2918

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster


Alignment Length:414 Identity:97/414 - (23%)
Similarity:172/414 - (41%) Gaps:50/414 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLW-DGASEIECGLTAKQKMANRPRQAVAHS 70
            :.:|:..:.:..|......|:..|::..|.:.|.|.: ||...|  |..|:......|..|..:.
  Fly    25 VDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTI--GEDAQTIGIKDPNSAYGYL 87

  Fly    71 FQLL-----QPKEELTEEKLSSALREIPCDFDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQV 130
            ..||     .|..:|..::.  ....|..|.::..:|||        :.|.|           :.
  Fly    88 LDLLGKTIDNPIVDLYRKRF--PYYNIVGDPERNTVVFR--------KSDTD-----------EF 131

  Fly   131 TVELLRAELEL-AHQYHTDGEQAPI--AVLSIPSYYPASAYKLLADAAQTAGFHVAQIITEPTAA 192
            :||.|.|:|.: |.|:..:..|.||  .||::|.|:..:..:.|..|||.|...|.|:|.:..|.
  Fly   132 SVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAV 196

  Fly   193 VLGYSIGE--EQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPF----------PIGGR 245
            .|.|.:..  |..|..::.|....|...:..|..|.|.....|.....|.          .:||.
  Fly   197 ALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTREINPVVQVLGVGYDRTLGGL 261

  Fly   246 QFTEALVQFICEEFR--RKYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVDYN 308
            :....|..::.:||.  :|.|.|...|.|::||:...|...|::|:........|::|::.:|:.
  Fly   262 EIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFK 326

  Fly   309 AQMSRARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPD 373
            ..::|.:.|.|.:.:.....:.|.|.:..:   |..|..|:.::|.|...::|::|..:.|....
  Fly   327 LPVTREKLEQLCEDLWPRATKPLEEALASS---HLSLDVINQVILFGGGTRVPRVQETIKAVIKQ 388

  Fly   374 AKLHNSHSADEVVAIGCARQAVCL 397
             :|..:.:|||...:|...:|..|
  Fly   389 -ELGKNLNADESATMGAVYKAADL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 95/409 (23%)
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 97/414 (23%)
HYOU1-like_NBD 23..409 CDD:212672 95/410 (23%)
TAF4 <572..>627 CDD:296797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.