DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and Hspa9

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001094128.2 Gene:Hspa9 / 291671 RGDID:1311806 Length:679 Species:Rattus norvegicus


Alignment Length:509 Identity:127/509 - (24%)
Similarity:227/509 - (44%) Gaps:56/509 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGK-AEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAH 69
            ||.:|.:..|:|.:  :|| |:|:.|.:|.|.:.:.:.:....|...|:.||::....|......
  Rat    57 GIDLGTTNSCVAVM--EGKQAKVLENAEGARTTPSVVAFTPDGERLVGMPAKRQAVTNPNNTFYA 119

  Fly    70 SFQLLQPKEELTEEKLSSALREIPCDFDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQVTVEL 134
            :.:|:..:.:  :.::....:.:|         |::   |.:...|.......|..|..|:...:
  Rat   120 TKRLIGRRYD--DPEVQKDTKNVP---------FKI---VRASNGDAWVEAHGKLYSPSQIGAFV 170

  Fly   135 LRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIG 199
            |....|.|..|.  |..|..||:::|:|:..|..:...||.|.:|.:|.::|.|||||.|.|.:.
  Rat   171 LMKMKETAENYL--GHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD 233

  Fly   200 EEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQFTEALVQFICEEFRRKYK 264
            :.:.   :.:.....||...||:...:|.|:|...:|.|...:||..|.:||::.|.:||:|:..
  Rat   234 KSED---KVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETG 295

  Fly   265 LDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSL-MDG---VDYNAQMSRARFESLIQPVIN 325
            :|..:...::.::|.||...|..|::...|.:.:..| ||.   ...|.:::||:||.::..:|.
  Rat   296 VDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIK 360

  Fly   326 NLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGC 390
            ..|   ..|.:..|......|.|.:::|:|...::||:|..|...|..|. ..:.:.||.||||.
  Rat   361 RTI---APCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAP-SKAVNPDEAVAIGA 421

  Fly   391 ARQA---------VCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLGRGSVLPAKIRIS 446
            |.|.         |.|:|.....|..|     ....:|         .||: .|.:.:|.|....
  Rat   422 AIQGGVLAGDVTDVLLLDVTPLSLGIE-----TLGGVF---------TKLI-NRNTTIPTKKSQV 471

  Fly   447 LPQSEEGKGDDVSKAAASFKLRTGESEILARLPDSTIP--EDGLYQLEVEVDVD 498
            ...:.:|:.....|.....:...|::::|.:.....||  ..|:.|:||..|:|
  Rat   472 FSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDID 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 103/392 (26%)
Hspa9NP_001094128.2 Interaction with NFS1. /evidence=ECO:0000250|UniProtKB:P38646 1..432 104/399 (26%)
dnaK 52..656 CDD:234715 127/509 (25%)
HSPA9-like_NBD 52..428 CDD:212683 104/395 (26%)
Interaction with FXN and ISCU. /evidence=ECO:0000250|UniProtKB:P38646 432..679 23/109 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.