DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and sks2

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_595438.1 Gene:sks2 / 2540199 PomBaseID:SPBC1709.05 Length:613 Species:Schizosaccharomyces pombe


Alignment Length:433 Identity:117/433 - (27%)
Similarity:203/433 - (46%) Gaps:67/433 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAHS 70
            ||.:|.:..|:| |......|:|.|.||.|.:.:.:.:.....: .|..||.:.|..||..|   
pombe    10 GIDLGTTYSCVA-VWETANVEIIPNDQGARTTPSFVAFTETERL-VGDAAKNQAAMNPRNTV--- 69

  Fly    71 FQLLQPKEELTEEKLSSALREIPCDFDKEELVFRMEHTVPSDREDQDD------RVV-------- 121
                                     ||.:.|:.|..    .|.|.|.|      :|:        
pombe    70 -------------------------FDAKRLIGRRY----EDPETQKDIKHWPFKVIDNNGIPTI 105

  Fly   122 -------TKDLSAYQVTVELLRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAG 179
                   .|..:|.:::..:|....|::..  ...::...||:::|:|:..|......||...||
pombe   106 EVNYLGEKKQFTAQEISAMVLTKMKEISEA--KLNKRVEKAVITVPAYFSDSQRAATKDAGAIAG 168

  Fly   180 FHVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGG 244
            .:|.:||.|||||.:.|.: :.::::.::||....||...|::...:|.|:|..|||.|...:||
pombe   169 LNVLRIINEPTAAAIAYGL-DAKSDKPKNVLIFDLGGGTFDVSLLKIQGGVFEVLATAGDTHLGG 232

  Fly   245 RQFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVDYNA 309
            ..|..|||:...:||:||.|:|..:..|::.::|:|....|..|:::..|.:.:|||.:|:|:::
pombe   233 EDFDNALVEHFIQEFKRKQKIDISDDPRALRRLRSACERAKRALSSVTQTTVEVDSLSNGIDFSS 297

  Fly   310 QMSRARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKID--DIVLLGATMQIPKLQAAVGARFP 372
            .::|||||.:........|..:.:.::.::     :.|.|  ||||:|.:.:|||:|..|...|.
pombe   298 SITRARFEDINATTFKATIDPVAKVLKDSK-----VPKADVHDIVLVGGSTRIPKVQRLVSDFFD 357

  Fly   373 DAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAE 415
            ...|:.|.:.||.||.|.|.||..|.:..:..  |.:|.::.:
pombe   358 GRALNKSINPDEAVAYGAAVQAAVLTNKADSD--KTQDLLLLD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 112/410 (27%)
sks2NP_595438.1 HSP70 8..613 CDD:278441 117/433 (27%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 114/414 (28%)
BAR <503..>603 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.