DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and HSPA4L

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001304310.1 Gene:HSPA4L / 22824 HGNCID:17041 Length:870 Species:Homo sapiens


Alignment Length:413 Identity:115/413 - (27%)
Similarity:196/413 - (47%) Gaps:55/413 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAHS 70
            ||.:|.....||..|:.| .|.|||:..||.:.||:.. |:.....|..||.::....|..: |.
Human    36 GIDLGFLNCYIAVARSGG-IETIANEYSDRCTPACISL-GSRTRAIGNAAKSQIVTNVRNTI-HG 97

  Fly    71 FQLL------QPKEELTEEKLSSALREIP-------CDFDKEELVFRMEHTVPSDREDQDDRVVT 122
            |:.|      .|..:....:|...|:::|       ..:.:||..|.:|                
Human    98 FKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIE---------------- 146

  Fly   123 KDLSAYQVTVELLRAELELAHQYHTDGEQAPIA--VLSIPSYYPASAYKLLADAAQTAGFHVAQI 185
                  |||..|| |:|:   :...:..:.|:|  |:||||::..:..:.:..|||.||.:..::
Human   147 ------QVTGMLL-AKLK---ETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRL 201

  Fly   186 ITEPTAAVLGYSIGEEQ----TEQRRHVLTIKCGGLYSDIAFYSVQNG-LFVQLATFGPFPIGGR 245
            :.|.||..|.|.|.::.    .|:.|:|:.|..|.....:...:...| |.|...||.|: :|||
Human   202 MNETTAVALAYGIYKQDLPPLDEKPRNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPY-LGGR 265

  Fly   246 QFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPS-TQLYIDSLMDGVDYNA 309
            .|.||||.:.|:||:.|||::..|:.|::.::.......|.:::...| ..|.|:..|:.:|.::
Human   266 NFDEALVDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSS 330

  Fly   310 QMSRARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDA 374
            :|:||:||.|...::..:...|...:|||..:...:|.|:   ::|...:||.::..: .:|...
Human   331 KMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIE---IVGGATRIPAVKEQI-TKFFLK 391

  Fly   375 KLHNSHSADEVVAIGCARQAVCL 397
            .:..:.:|||.||.|||.|...|
Human   392 DISTTLNADEAVARGCALQCAIL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 113/408 (28%)
HSPA4LNP_001304310.1 HSPA4L_NBD 33..415 CDD:212688 115/413 (28%)
HSP70 34..725 CDD:278441 115/413 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.