DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and Hspa4

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_032326.3 Gene:Hspa4 / 15525 MGIID:1342292 Length:842 Species:Mus musculus


Alignment Length:521 Identity:120/521 - (23%)
Similarity:212/521 - (40%) Gaps:74/521 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVA-- 68
            ||.:|..:..:|..||.| .|.|||:..||.:.||:.: |......|..||.::.:..:..|.  
Mouse     5 GIDLGFQSCYVAVARAGG-IETIANEYSDRCTPACVSF-GPKNRSIGAAAKSQVISNAKNTVQGF 67

  Fly    69 ---HSFQLLQPKEELTEEKLSSALREIPCDFDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQV 130
               |......|..|..:..|:..:.::|......::.:..|.               ::.:..||
Mouse    68 KRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEE---------------RNFTTEQV 117

  Fly   131 TVELLRAELELAHQYHTDGEQAPI--AVLSIPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAV 193
            |..||....|.|...    .:.|:  .|:|:||:|..:..:.:.||.|.||.:..:::.|.||..
Mouse   118 TAMLLSKLKETAESV----LKKPVVDCVVSVPSFYTDAERRSVMDATQIAGLNCLRLMNETTAVA 178

  Fly   194 LGYSIGEEQ----TEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQFTEALVQF 254
            |.|.|.::.    .|:.|:|:.:..|.....::..:...|....|||.....:|||:|.|.||..
Mouse   179 LAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNKGKLKVLATAFDTTLGGRKFDEVLVNH 243

  Fly   255 ICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPS-TQLYIDSLMDGVDYNAQMSRARFES 318
            .||||.:|||||.....|::.::.......|.:::...| ..|.|:..|:.:|.:..|:|.:|..
Mouse   244 FCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDIDVSGTMNRGKFLE 308

  Fly   319 LIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSAD 383
            :...::..:...|...:||::.:...:..::   ::|...:||.::..: ::|...:|..:.:||
Mouse   309 MCDDLLARVEPPLRSVLEQSKLKKEDIYAVE---IVGGATRIPAVKEKI-SKFFGKELSTTLNAD 369

  Fly   384 EVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLGRGSVLPAKIRISLP 448
            |.|..|||.|...|....:.:.....|.|                         ..|..:|.:.|
Mouse   370 EAVTRGCALQCAILSPAFKVREFSITDVV-------------------------PYPISLRWNSP 409

  Fly   449 QSEEGKGD----------DVSKAAASFKLRTGESEILARLP-DSTIPEDGLYQLEVEVDVDDKDG 502
             :|||..|          ..||....::......|.....| |...|:..:.|..|:......||
Mouse   410 -AEEGLSDCEVFPKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDG 473

  Fly   503 N 503
            :
Mouse   474 S 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 99/399 (25%)
Hspa4NP_032326.3 HSPA4_NBD 2..384 CDD:212687 100/403 (25%)
HSP70 3..609 CDD:278441 120/521 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..577
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.