DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and Hspa5

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001156906.1 Gene:Hspa5 / 14828 MGIID:95835 Length:655 Species:Mus musculus


Alignment Length:534 Identity:124/534 - (23%)
Similarity:226/534 - (42%) Gaps:102/534 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAHS 70
            ||.:|.:..|:. |..:|:.|:|||.||:|::.:.:.:....|...|..||.::.:.|...|   
Mouse    33 GIDLGTTYSCVG-VFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTV--- 93

  Fly    71 FQLLQPKEELTEEKLSSALREIPCDFDKEELVFRM--EHTVPSDREDQDDRVVTKDLSAY----- 128
                                     ||.:.|:.|.  :.:|..|.:....:||.|....|     
Mouse    94 -------------------------FDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDI 133

  Fly   129 -----------QVTVELLRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAGFHV 182
                       :::..:|....|.|..|.  |::...||:::|:|:..:..:...||...||.:|
Mouse   134 GGGQTKTFAPEEISAMVLTKMKETAEAYL--GKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 196

  Fly   183 AQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQF 247
            .:||.|||||.:.|  |.::.|..:::|....||...|::..::.||:|..:||.|...:||..|
Mouse   197 MRIINEPTAAAIAY--GLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDF 259

  Fly   248 TEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVDYNAQMS 312
            .:.:::...:.:::|...|..:..|:|.|:|......|..|::....::.|:|..:|.|::..::
Mouse   260 DQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLT 324

  Fly   313 RARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDAKLH 377
            ||:||.|...:..:.::.:.:.:|.:..:.   |.||:|||:|.:.:|||:|..|...|...:..
Mouse   325 RAKFEELNMDLFRSTMKPVQKVLEDSDLKK---SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPS 386

  Fly   378 NSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVL--------- 433
            ...:.||.||.|.|.||..|                         ..|:....|||         
Mouse   387 RGINPDEAVAYGAAVQAGVL-------------------------SGDQDTGDLVLLDVCPLTLG 426

  Fly   434 ------------GRGSVLPAKIRISLPQSEEGKGDDVSKAAASFKLRTGESEILARLPDSTIP-- 484
                        .|.:|:|.|.......:.:.:.....|.....:..|.::.:|.....:.||  
Mouse   427 IETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA 491

  Fly   485 EDGLYQLEVEVDVD 498
            ..|:.|:||..::|
Mouse   492 PRGVPQIEVTFEID 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 103/405 (25%)
Hspa5NP_001156906.1 Required for interaction with KIAA1324. /evidence=ECO:0000250|UniProtKB:P11021 1..81 15/48 (31%)
HSP70 31..636 CDD:365808 124/534 (23%)
Nucleotide-binding (NBD). /evidence=ECO:0000250|UniProtKB:P11021 126..281 40/158 (25%)
Interdomain linker. /evidence=ECO:0000250|UniProtKB:G3I8R9 410..420 3/9 (33%)
Substrate-binding (SBD). /evidence=ECO:0000250|UniProtKB:P11021 421..501 12/79 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..655
Prevents secretion from ER 652..655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.