DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and HSPH1

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001273433.1 Gene:HSPH1 / 10808 HGNCID:16969 Length:860 Species:Homo sapiens


Alignment Length:529 Identity:118/529 - (22%)
Similarity:208/529 - (39%) Gaps:108/529 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GASEIECGLTAKQKMANRPRQAVA-----HSFQLLQPKEELTEEKLSSALREIPCD--------- 95
            |:.....|:.||.:........|:     |......|..:..:|.||..|  :|..         
Human    44 GSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAFNDPFIQKEKENLSYDL--VPLKNGGVGIKVM 106

  Fly    96 FDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQVTVELLRAELELAHQYHTDGEQAPI--AVLS 158
            :..||.:|.:|                      |:|..||....|.|.    :..:.|:  .|:|
Human   107 YMGEEHLFSVE----------------------QITAMLLTKLKETAE----NSLKKPVTDCVIS 145

  Fly   159 IPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQ----TEQRRHVLTIKCGGLYS 219
            :||::..:..:.:.||||..|.:..:::.:.||..|.|.|.::.    .|:.|.|:.:..|....
Human   146 VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAF 210

  Fly   220 DIAFYSVQNGLFVQLAT-FGPFPIGGRQFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAAN 283
            .::..:...|....|.| |.|| :||:.|.|.||:..|.||:.|||||.....|::.::......
Human   211 QVSACAFNKGKLKVLGTAFDPF-LGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEK 274

  Fly   284 CKHIL----TTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQAQKEHPG 344
            .|.::    |.:|   |.|:..|:..|.:.:|:|::||.|...::..:...|...:||.   |..
Human   275 LKKLMSSNSTDLP---LNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQT---HLK 333

  Fly   345 LSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEE 409
            :..:..:.::|...:||.::..: |:|....:..:.:|||.||.|||.|...|....:.:.....
Human   334 VEDVSAVEIVGGATRIPAVKERI-AKFFGKDISTTLNADEAVARGCALQCAILSPAFKVREFSVT 397

  Fly   410 DCVVAEDDLFIWHGNDESNAKL--VLGRGSVLP-AKI-------------------RISLPQSEE 452
            |.|.....| ||:.:.|....:  |..|....| :|:                   .:..|:::.
Human   398 DAVPFPISL-IWNHDSEDTEGVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKI 461

  Fly   453 GK--------GDDVSKAAASFKLRTGESEIL----ARLPDSTIPEDGLYQLEVEVDVD------- 498
            |:        ..|..|:....|:|.....|.    |.:.:....|:.  ::..|.|::       
Human   462 GRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEEN--EMSSEADMECLNQRPP 524

  Fly   499 ---DKDGNV 504
               |.|.||
Human   525 ENPDTDKNV 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 91/373 (24%)
HSPH1NP_001273433.1 NBD_sugar-kinase_HSP70_actin 39..386 CDD:327376 92/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.