DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and HYOU1

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_005271449.1 Gene:HYOU1 / 10525 HGNCID:16931 Length:1000 Species:Homo sapiens


Alignment Length:454 Identity:101/454 - (22%)
Similarity:186/454 - (40%) Gaps:96/454 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACL--------LWDGASEI-----ECGLTAKQ- 57
            :.:|:.::.:|.|:.....|::.||:..|.:...:        ..|.|:.:     :..|...| 
Human    38 VDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQH 102

  Fly    58 ---KMANRPRQAVAHSFQLLQPKEELTEEKLSSALREIPCDFD--KEELVFRMEHTVPSDREDQD 117
               |.|:.|..|:   :|...|:.|||              ||  ::.:.|::...:....|   
Human   103 LLGKQADNPHVAL---YQARFPEHELT--------------FDPQRQTVHFQISSQLQFSPE--- 147

  Fly   118 DRVVTKDLSAYQVTVELLRAELELAHQYHTDGEQAPI--AVLSIPSYYPASAYKLLADAAQTAGF 180
                           |:|...|..:.....|..:.||  ||:::|.::..:..:.:..||:.||.
Human   148 ---------------EVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGL 197

  Fly   181 HVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFV-QLATF------- 237
            .|.|:|.:.||..|.|.:     .:|:.:.|..     .:|.||.:.:|..| .:.|:       
Human   198 KVLQLINDNTATALSYGV-----FRRKDINTTA-----QNIMFYDMGSGSTVCTIVTYQMVKTKE 252

  Fly   238 -GPFP------------IGGRQ----FTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCK 285
             |..|            :||.:    ..|.|.....|:.:.:...|..|:.|::||:...|...|
Human   253 AGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLK 317

  Fly   286 HILTTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQA-QKEHPGLSKID 349
            .:|:........|:.|||.||:.|:::|..||.|..    :|.:::...|:|| |.....|.:|:
Human   318 TVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCA----DLFERVPGPVQQALQSAEMSLDEIE 378

  Fly   350 DIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVV 413
            .::|:|...::|::|..:.......:|..:.:|||..|:|...||..|....:.:.....|.||
Human   379 QVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 95/433 (22%)
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 101/454 (22%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 96/434 (22%)
PHA00666 601..>739 CDD:222808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.