DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex2 and pex2

DIOPT Version :9

Sequence 1:NP_648210.1 Gene:Pex2 / 38941 FlyBaseID:FBgn0035876 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001016841.1 Gene:pex2 / 549595 XenbaseID:XB-GENE-1016618 Length:306 Species:Xenopus tropicalis


Alignment Length:295 Identity:96/295 - (32%)
Similarity:146/295 - (49%) Gaps:40/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKNKYVPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKR 65
            ||:...|.|::|:|||.|||.:.:||........|...|.|..:.:||:...:...:|..::..:
 Frog     8 MEEINPVLRISQLDAIELNKALEQLIWSQFNSCFQGFKPGLLTRFEPEIKAFLCLFLWRYTIYTK 72

  Fly    66 CSTFGQQLLVLAY--DAEKLTVSRLV-----LHFILTVLPGYVKSW-EERRLT-----------R 111
            .:|.||.:|.:.|  |.|.....|.:     :.|.|.::.|   .| |||...           :
 Frog    73 NATVGQAILNMQYKNDLEATKNYRPLNKQQKVWFALFMVGG---KWLEERSFDLFSNHPFGASFQ 134

  Fly   112 RVEWFSEAIMWVENSALIL--NILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYKYLTR 174
            |.::|..||     |.|:.  .:||:..||:.|:..||.:.|||:..:..|....|.:|::|:.|
 Frog   135 RTKYFLNAI-----SGLLKFGALLNFLIFLQQGKFATLTERLLGIRSVFSRPQDVRQVGFEYMNR 194

  Fly   175 ELLWGGFMEILGLVLPIINFRKLQRVLKSW--TFSGRRLEDRDGPAFLAPQM-TLSTTCTFCGER 236
            |:||.||.|.|..:||:||.:||:..|.||  ...|..|.|        |.: .:...|..|||.
 Frog   195 EILWHGFAEFLIFLLPLINTQKLKSKLFSWCKPAKGHSLSD--------PSLAVICKECCLCGEW 251

  Fly   237 PTLPHHMGCGHIYCYYCLNANVLTDASFCCPNCGS 271
            |.:||.:||.|::||||:.:|.:.|..|.||.|.|
 Frog   252 PAMPHTIGCSHVFCYYCIKSNYMADMYFTCPKCSS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex2NP_648210.1 Pex2_Pex12 22..207 CDD:282595 60/207 (29%)
RING 230..269 CDD:214546 19/38 (50%)
pex2NP_001016841.1 Pex2_Pex12 27..225 CDD:368100 60/205 (29%)
RING-HC_PEX2 244..285 CDD:319440 19/40 (48%)
RING-HC finger (C3HC4-type) 245..284 CDD:319440 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8929
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H269
Inparanoid 1 1.050 144 1.000 Inparanoid score I4354
OMA 1 1.010 - - QHG53949
OrthoDB 1 1.010 - - D1494604at2759
OrthoFinder 1 1.000 - - FOG0005881
OrthoInspector 1 1.000 - - oto104460
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5623
SonicParanoid 1 1.000 - - X5660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.