DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and CG34461

DIOPT Version :9

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:170 Identity:78/170 - (45%)
Similarity:88/170 - (51%) Gaps:53/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQIERISLGEEHGHLEHAEPHYE 70
            |:||:|    .|.|:|..:|..:     |.||.|...|..               |..||||   
  Fly     9 LLFAAA----QAVPIELGHYAPA-----LVHHAPVLSHAV---------------HAVHAEP--- 46

  Fly    71 THESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTA 135
                         .|.|||:|.||:.|.||||:|||.|.||||.|||||||||||||:|||||||
  Fly    47 -------------VAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTA 98

  Fly   136 DKHNGFNAVVHKTAP---VHHHEELHE----------HHY 162
            |.|||||||||||||   :.|...||.          |||
  Fly    99 DDHNGFNAVVHKTAPSKIIAHAPVLHAAPVLAHAPLLHHY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 40/51 (78%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130248at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.