DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:168 Identity:59/168 - (35%)
Similarity:79/168 - (47%) Gaps:53/168 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLA----HHEPEPIHEYGHHQIE-----RISLG 56
            ||||: :||.|. :::|          |.||..:|    :|....:..|.|..:.     .:...
  Fly     1 MAFKF-VFALAF-VAVA----------SAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAA 53

  Fly    57 EEHGHLEHAEPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSL 121
            ||:      :||                  |:|.|.|||:|..|||.|.|.|.||||.|:|:|||
  Fly    54 EEY------DPH------------------PQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSL 94

  Fly   122 VEPDGSIRTVDYTADKHNGFNAVVHK--------TAPV 151
            ::.||..|.|.||||..|||||||::        .|||
  Fly    95 IDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVAPV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 30/51 (59%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.