DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr76Bc

DIOPT Version :10

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:102 Identity:54/102 - (52%)
Similarity:65/102 - (63%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ISLGEEHGHLEHAEPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKG 117
            :.:.|:...:|:| |||| |:.              |||.|||.|.||||||||.|:||||.|||
  Fly    36 VVIDEDDETMEYA-PHYE-HQG--------------YAFSYGVKDLHTGDVKSQWESRDGDGVKG 84

  Fly   118 QYSLVEPDGSIRTVDYTADKHNGFNAVVHKTAPVHHH 154
            .||::|||||||||.||||...||||:| ||...:.|
  Fly    85 HYSVLEPDGSIRTVHYTADAKKGFNAIV-KTVGANSH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 38/51 (75%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 38/51 (75%)

Return to query results.
Submit another query.