DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr67B

DIOPT Version :9

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:183 Identity:52/183 - (28%)
Similarity:70/183 - (38%) Gaps:41/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYLIFASALCLSLA----------YPLEHQYYEES------HGYEHLAHHEPEPIHEYGHHQIER 52
            |..|.|:.|..:||          .|.|.|.:..|      ...|:.......|:.|..:.:.|.
  Fly     2 KCYILAALLLATLASGENIFKINITPEEAQQFLNSAQLRGIGDIEYAPKTGENPLPEARNEKGEF 66

  Fly    53 ISLGE--EHGHLEHAEPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTV 115
            :.:|.  ||.. |:.|.||:.|:.||.|        ....|.||..|::.|..:.:.||   ..|
  Fly    67 VYMGRVIEHPE-EYVEEHYDAHQYHGQD--------GLGQFAYGYRDWNQGKNEKRDET---GKV 119

  Fly   116 KGQYSLVEPDGSIRTVDYTADKHNGF----NAVVH------KTAPVHHHEELH 158
            .|.|..|:|.|.....:|.||| .||    |...|      ||..|...||.|
  Fly   120 TGSYKYVQPHGRDFVANYYADK-TGFHVEDNRPAHLKLPATKTPAVLKAEEEH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 17/51 (33%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.