DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:69 Identity:19/69 - (27%)
Similarity:30/69 - (43%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YAFKY----GVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAVVHKTA 149
            |||.:    |::......:|:.....:...::|....|.|||....::|.||: |||.|......
  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQAQGEHLP 104

  Fly   150 PVHH 153
            .|.|
  Fly   105 QVEH 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 14/55 (25%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.