DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr64Ad

DIOPT Version :10

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:73 Identity:46/73 - (63%)
Similarity:50/73 - (68%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNA 143
            |.||  |.|:|.|.|.|.|..|||.|:|.||||||.|:|.|||:|||||.|.|.|.||..|||||
  Fly   138 EIVD--AHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNA 200

  Fly   144 VVHKTAPV 151
            ||.|..||
  Fly   201 VVQKDVPV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 32/51 (63%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.