DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:77/158 - (48%)
Similarity:87/158 - (55%) Gaps:43/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQIERISLGEEHGH---L 62
            |||    |.|.:||::                                 :...|.|..|||   |
  Fly     1 MAF----FKSLICLAV---------------------------------LSAASAGVLHGHGAGL 28

  Fly    63 EHAEPHYETHESHG-HDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDG 126
            ..|.|  ..:..|| |||.:||:|.|||.:.|||.|.||||||||||.||||.|||.||||||||
  Fly    29 YAAAP--AIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDG 91

  Fly   127 SIRTVDYTADKHNGFNAVVHKTAPVHHH 154
            |:|||:||||.|||||||||||.|..||
  Fly    92 SVRTVEYTADDHNGFNAVVHKTGPTVHH 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 40/51 (78%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130248at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.