DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr51A

DIOPT Version :9

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:145 Identity:39/145 - (26%)
Similarity:62/145 - (42%) Gaps:52/145 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKYLIFASAL-CLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQIERISLGEEHGHLEHAE 66
            :|:::.||.| .|.:|.|                     |..|....:|||    ||        
  Fly     2 YKFVLIASLLVALCMAAP---------------------PRQESEAERIER----EE-------- 33

  Fly    67 PHYETHESHGHDEHVDYYAPPKYAFKYGVND-FHTGDVKSQHETRDGDTVKGQYSLVEPDGSI-R 129
              ||.:::..          .:|:|...|:| .:.|.: |::|.|:|.||:|.||..  ||.: |
  Fly    34 --YEKYQNEN----------AQYSFNSSVDDKINDGQI-SRNEEREGGTVRGSYSYF--DGFVKR 83

  Fly   130 TVDYTADKHNGFNAV 144
            .|:|.||| :|:..:
  Fly    84 RVEYIADK-DGYRVL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 22/53 (42%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:278791 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.