DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:66 Identity:19/66 - (28%)
Similarity:30/66 - (45%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YAPPKYAFKY----GVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAV 144
            |....|::.|    |::....|...:....:..:.|:|.||.:.|:|....|.|.||. |||..|
  Fly    78 YGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLADA-NGFRPV 141

  Fly   145 V 145
            :
  Fly   142 I 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 15/55 (27%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.