DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66Cb and CG42367

DIOPT Version :10

Sequence 1:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:63 Identity:36/63 - (57%)
Similarity:44/63 - (69%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 APPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAVVHK 147
            :|.:|.|.|.|:|.|:||||.|.|.|.|:.|.|:||||:|||..|.||||||...||||.|.:
  Fly    35 SPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 30/51 (59%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 28/46 (61%)

Return to query results.
Submit another query.