DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13670 and Cpr47Ea

DIOPT Version :10

Sequence 1:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:64 Identity:19/64 - (29%)
Similarity:31/64 - (48%) Gaps:7/64 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PEYSFAY------GVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAE 158
            |:.|:.|      |:...:...|:|.........::|.||...|||.:..:.|.||: ||::||
  Fly    52 PDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADE-NGYRAE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790 15/57 (26%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.