DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13670 and Cpr23B

DIOPT Version :10

Sequence 1:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:57 Identity:31/57 - (54%)
Similarity:37/57 - (64%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 YSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEV 159
            |||.|.|.|..|..::...|||:|..|||.||::||||..|.|.|||||.:||.|.|
  Fly   157 YSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790 27/51 (53%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.