DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BI-1 and tmbim6

DIOPT Version :9

Sequence 1:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001017100.1 Gene:tmbim6 / 549854 XenbaseID:XB-GENE-952610 Length:237 Species:Xenopus tropicalis


Alignment Length:218 Identity:82/218 - (37%)
Similarity:130/218 - (59%) Gaps:9/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 REHLSKVYMVLGSTAAATAMGAMLQ-MRDFLDLGVLAAVATLVLVLGL----HFYKDDGKNYYTR 87
            ::||.:||..........|.||.:. :..||....|:...:|.:::.|    |.|:.:.|    |
 Frog    24 QQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKK----R 84

  Fly    88 LGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVS 152
            ||:|..|.|.||..|||.|....:|||:||.:|..||.:.||..|||||.|::..:|:|||:|:|
 Frog    85 LGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMS 149

  Fly   153 VINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDV 217
            .::.:.|.||.|::..|..:....:|:|:.||..|:::|||.|:||...|::|.|.|.:|||.|.
 Frog   150 ALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDF 214

  Fly   218 LSMFRRLLIILTQKEERKQNERR 240
            :::||:|::||...|:.|:.||:
 Frog   215 ITIFRKLMVILAMNEKEKRKERK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BI-1NP_648205.1 BI-1 21..233 CDD:198412 78/209 (37%)
tmbim6NP_001017100.1 BI-1 16..230 CDD:198412 78/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5975
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2419
Inparanoid 1 1.050 115 1.000 Inparanoid score I4685
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275249at2759
OrthoFinder 1 1.000 - - FOG0004991
OrthoInspector 1 1.000 - - oto103418
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.