DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BI-1 and tegt

DIOPT Version :9

Sequence 1:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002663718.1 Gene:tegt / 373123 ZFINID:ZDB-GENE-030826-10 Length:236 Species:Danio rerio


Alignment Length:213 Identity:75/213 - (35%)
Similarity:126/213 - (59%) Gaps:0/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 REHLSKVYMVLGSTAAATAMGAMLQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLY 92
            ::||..||..|.........|:.:.:...:..|.|..:.:|.::..|.......:....||.:|.
Zfish    24 QQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAMTPHSPQTEKKRLAILA 88

  Fly    93 AFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTM 157
            ||.|.:|..||||:.|..||:|:||::|..||.:.|...:||||.|::..||:|||.|::.:..:
Zfish    89 AFAFFTGLGLGPLMDYAISIDPSIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVL 153

  Fly   158 ALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDVLSMFR 222
            .|:|:.||.|.|..:....||:|:.||..|:::|||.|:||...|::|.:.|.:|||.|.:::||
Zfish   154 LLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFR 218

  Fly   223 RLLIILTQKEERKQNERR 240
            :|:|:|:..|:.|:.|::
Zfish   219 KLVILLSMNEKEKKKEKK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BI-1NP_648205.1 BI-1 21..233 CDD:198412 72/204 (35%)
tegtXP_002663718.1 BI-1 16..227 CDD:198412 72/202 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574770
Domainoid 1 1.000 138 1.000 Domainoid score I4825
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2419
Inparanoid 1 1.050 148 1.000 Inparanoid score I4374
OMA 1 1.010 - - QHG54832
OrthoDB 1 1.010 - - D1275249at2759
OrthoFinder 1 1.000 - - FOG0004991
OrthoInspector 1 1.000 - - oto40469
orthoMCL 1 0.900 - - OOG6_103839
Panther 1 1.100 - - LDO PTHR23291
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.