DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BI-1 and Tmbim6

DIOPT Version :9

Sequence 1:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_062254.2 Gene:Tmbim6 / 24822 RGDID:3842 Length:237 Species:Rattus norvegicus


Alignment Length:221 Identity:83/221 - (37%)
Similarity:134/221 - (60%) Gaps:9/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYVREHLSKVYMVLGSTAAATAMGAMLQ-MRDFLDLGVLAAVATLVLVLGL----HFYKDDGKNY 84
            |..::||.|||..........|.||.:. :..|:..|:|:|:..|.|::.|    |.::.:.|  
  Rat    21 PSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQK-- 83

  Fly    85 YTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGM 149
              |||:|..|.|.:|..|||.|....:|||:|:.:|..||.:.|...|||||.|.:..||:|||:
  Rat    84 --RLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGI 146

  Fly   150 LVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLF 214
            |:|.::.|.:.||.|:.|.|.::....||:|:.||..|:::|||.|:||..:|::|.:.|.:|||
  Rat   147 LMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCIDLF 211

  Fly   215 FDVLSMFRRLLIILTQKEERKQNERR 240
            .|.:::||:|::||...|:.|:.|::
  Rat   212 LDFVTLFRKLMLILAFNEKDKKKEKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BI-1NP_648205.1 BI-1 21..233 CDD:198412 80/212 (38%)
Tmbim6NP_062254.2 BI-1 16..228 CDD:198412 80/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335595
Domainoid 1 1.000 144 1.000 Domainoid score I4511
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2419
Inparanoid 1 1.050 153 1.000 Inparanoid score I4256
OMA 1 1.010 - - QHG54832
OrthoDB 1 1.010 - - D1275249at2759
OrthoFinder 1 1.000 - - FOG0004991
OrthoInspector 1 1.000 - - oto96711
orthoMCL 1 0.900 - - OOG6_103839
Panther 1 1.100 - - LDO PTHR23291
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.