DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BI-1 and K11H12.8

DIOPT Version :9

Sequence 1:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_741296.1 Gene:K11H12.8 / 176892 WormBaseID:WBGene00019664 Length:342 Species:Caenorhabditis elegans


Alignment Length:250 Identity:59/250 - (23%)
Similarity:102/250 - (40%) Gaps:71/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YVREHLSKVYMVLGSTAAATAM-----------------GAMLQMRDFLDLGVLAA-VATLVLVL 72
            ||||.:|..|..|..:.|.||:                 |.|:.:     .|.:|| :|:.:|..
 Worm   108 YVRERISTTYAYLAGSLALTAVSGVAASRSAAIMRLTAGGGMMSL-----FGTMAAMIASGMLAR 167

  Fly    73 GLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALL 137
            .:        :|.:.:....|:....| .||.:...:|.:...::..|...|......||.:|:.
 Worm   168 SI--------DYESTVAKHLAWALHCG-VLGAVFAPLCFMAGPVLTRAAWYTAGIVGGLSATAIT 223

  Fly   138 AEQGKYLYLGGML------VSVINTMALL---------SLFNMVFKSYFVQVTQLYVGVFVMAAF 187
            |...|:|.:.|.|      |.|.|..|..         ||.::|          :|.|:.:.:||
 Worm   224 APSEKFLMMSGPLAMGFGVVFVANIGAFFLPPGSALGASLASIV----------VYGGLILFSAF 278

  Fly   188 IVYDTQNIVEKCRN--------------GNRDVVQHALDLFFDVLSMFRRLLIIL 228
            ::||||.:|:|..|              .:.|.:...:.::.|||::|.||::|:
 Worm   279 LLYDTQRLVKKAENHPHSSQLYGSDMQIRSFDPINAQMSIYMDVLNIFMRLVMIM 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BI-1NP_648205.1 BI-1 21..233 CDD:198412 59/249 (24%)
K11H12.8NP_741296.1 GHITM 71..340 CDD:198413 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.