DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BI-1 and Tmbim6

DIOPT Version :9

Sequence 1:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001164505.1 Gene:Tmbim6 / 110213 MGIID:99682 Length:237 Species:Mus musculus


Alignment Length:221 Identity:83/221 - (37%)
Similarity:135/221 - (61%) Gaps:9/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYVREHLSKVYMVLGSTAAATAMGAMLQ-MRDFLDLGVLAAVATLVLVLGL----HFYKDDGKNY 84
            |..::||.|||..........|.||.:. :..|:..|:|:|:.:|.|::.|    |.::.:.|  
Mouse    21 PSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQK-- 83

  Fly    85 YTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGM 149
              |||:|..|.|.:|..|||.|....::||:|:.:|..||.:.|...|||||.|.:..||:|||:
Mouse    84 --RLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGI 146

  Fly   150 LVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLF 214
            |:|.::.|.|.||.|:.|.|.::....||:|:.||..|:::|||.|:||..:|::|.:.|.:|||
Mouse   147 LMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLF 211

  Fly   215 FDVLSMFRRLLIILTQKEERKQNERR 240
            .|.:::||:|::||...|:.|:.|::
Mouse   212 LDFVTLFRKLMLILAFNEKDKKKEKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BI-1NP_648205.1 BI-1 21..233 CDD:198412 80/212 (38%)
Tmbim6NP_001164505.1 BI-1 16..228 CDD:198412 80/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831922
Domainoid 1 1.000 146 1.000 Domainoid score I4544
eggNOG 1 0.900 - - E1_KOG1629
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2419
Inparanoid 1 1.050 155 1.000 Inparanoid score I4298
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54832
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004991
OrthoInspector 1 1.000 - - oto93163
orthoMCL 1 0.900 - - OOG6_103839
Panther 1 1.100 - - LDO PTHR23291
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.