DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr93a

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:74/178 - (41%) Gaps:11/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KLNNLCQVHDEICEIGKALNELW--SYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKN 382
            ::..||...||:.|.....:||:  :.....::.:..|.:....:...|...||.|.......:.
  Fly   242 RMQLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLMLYQYILHFLNDDEV 306

  Fly   383 PFITVIVLSYTSGKCVYLIYLSWKT---SQASKRTGISLHKCGVVAD-DNLLYEIVNHLSLKLLN 443
            .|:::::........|.|:..:..|   |:..|:..:.:    |.:| |....:.|.....:|..
  Fly   307 VFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKLPLDI----VCSDMDERWDKSVETFLGQLQT 367

  Fly   444 HSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNLAAQ-QAKEAIQ 490
            ..::....|||.|:.|.:..:...|.|||.|||||.:... :|.|.|:
  Fly   368 QRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGITGGFEASEDIK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 35/163 (21%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.