DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr33a

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:553 Identity:106/553 - (19%)
Similarity:200/553 - (36%) Gaps:157/553 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QQLFFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVVLYNILIYSFGEEDRSLKASQ 80
            |.:.:.|.:.|::|.:.::..:..:|:.:     .|....|.||..|.::               
  Fly     3 QIMNWFSMVIGLIPLNRQQSETNFILDYA-----MMCIVPIFYVACYLLI--------------- 47

  Fly    81 STLTFVIGLFL---------------TYIGLIMMVSDQLTALRNQGRIGELYE-RIRLVDERLYK 129
             .|:.:|||.|               .::|..:.::..|.:|..:....:.:: |:..:|..:.|
  Fly    48 -NLSHIIGLCLLDSCNSVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQK 111

  Fly   130 EGC----VMDNSTIGRRIRIMLIM-TVIFELSIL----VSTYVKLVD----YSQWMSLLWI---V 178
              |    .||      ::::..:. :|.:..:.|    |.|:....|    |..:.:|.:|   |
  Fly   112 --CQRVAEMD------KVKVTAVKHSVAYHFTWLFLFCVFTFALYYDVRSLYLTFGNLAFIPFMV 168

  Fly   179 SAIPTFINTLDKIWFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQY 243
            |:.|....::.:..|...:..:.:|||.||..||::             |||.            
  Fly   169 SSFPYLAGSIIQGEFIYHVSVISQRFEQINMLLEKI-------------NQEA------------ 208

  Fly   244 DSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPV----AHSMNSFGEAIDAA--------SRKP 296
                .:.:..|...||.|.||..     :..|.|:    ..:...||.....|        .:|.
  Fly   209 ----RHRHAPLTVFDIESEGKKE-----RKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKN 264

  Fly   297 PPPPLAT------------NMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSL 349
            ....|.|            |.......||.:  |..|.:|.::||:|..:....|..:....:..
  Fly   265 DDDDLDTSNDEDEDDFDYDNATIAENTGNTS--EANLPDLFKLHDKILALSVITNGEFGPQCVPY 327

  Fly   350 MAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKNPFIT-------------VIVLSYTSGKCVYLI 401
            ||..|::               ||..:|...|..||.             .::.|:|:....|::
  Fly   328 MAACFVV---------------SIFGIFLETKVNFIVGGKSRLLDYMTYLYVIWSFTTMMVAYIV 377

  Fly   402 Y-LSWKTSQASKRTGISLH-----KCGVVADDNLLYEIVNHLSLKLLNHS--VDFSACGFFTLDM 458
            . |....:..||::.:.:|     |...:..::|.|..:...:|:.|:..  ..|:..|.|.||.
  Fly   378 LRLCCNANNHSKQSAMIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDY 442

  Fly   459 ETLYGVSGGITSYLIILIQFNLAAQQAKEAIQT 491
            ..::......|||||:|:||::.|....|.:.:
  Fly   443 TFIFSTVSAATSYLIVLLQFDMTAILRNEGLMS 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 101/533 (19%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 43/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.