DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr9a

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:413 Identity:73/413 - (17%)
Similarity:126/413 - (30%) Gaps:163/413 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTF-------INTLD 189
            |....|.:||.:....::.::.||...:.||....:...        .::|.:       :|...
  Fly    20 CGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDN--------ESVPAYFAKVIMGVNMAY 76

  Fly   190 KI---WFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQ------------ 239
            |:   |.|:|......||..:   ||||                  ||:.::.            
  Fly    77 KMIHAWIALSALFECRRFRYL---LEEL------------------PPVKATSFIYRHLILEIIL 120

  Fly   240 --------------PPQYDSNLEYLYK----------------ELGGMDIGSIGKSSVSGSGKNK 274
                          ...|..||.|.|.                .|.| .:..:....:|||...|
  Fly   121 FACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDG-KLEQLHHRVISGSSDYK 184

  Fly   275 VAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALN 339
            .                         |..:..|      .|||...|::|..:            
  Fly   185 T-------------------------LRLDYAH------LAKVTRSLSHLFGL------------ 206

  Fly   340 ELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIP-SLFRSAKNPFITVIVLSYTSGKCVYLIYL 403
               |..:|:::..|..|....:||:  ....|.:| :||...:..|:.          |..||.:
  Fly   207 ---SLLLLNVLCLGDWIIVCNVYFM--VAYLQVLPATLFLFGQVMFVV----------CPTLIKI 256

  Fly   404 SWKTSQASKRTGISLHKCGVVADDNLLYEI-------------VNHLSLKLLNHSVDFSACGFFT 455
             |....||       |:| |....:|..::             :...:|:::...:....||.:.
  Fly   257 -WSICAAS-------HRC-VSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYH 312

  Fly   456 LDMETLYGVSGGITSYLIILIQF 478
            |:::||.|:...|...|:|.:||
  Fly   313 LNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 71/411 (17%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 71/411 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.