DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr22a

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:97/251 - (38%) Gaps:79/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PLLQQFQQLFFISKIAGILPQDLEKF-RSRNL---------LEKS------------------RN 46
            ||::|.::|..:..:...|...|..| ||..|         |:|:                  ..
  Fly    84 PLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLMLSECHTFNRYVIEK 148

  Fly    47 GMIYML---STLILY-------VVLYN-ILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLIMMV 100
            |::.:|   |:|:||       :|:|. :.||..     .|:.....:.|.:.:...| ..:.::
  Fly   149 GLVIILEIGSSLVLYFGIPNSKIVVYEAVCIYIV-----QLEVLMVVMHFHLAVIYIY-RYLWII 207

  Fly   101 SDQLTALRNQGRIGE------------LYERIRLVDERLYKEGCVMDNSTIGRRIRIMLIMTVIF 153
            :.||..:.::.|.|:            ||.|:..::.||   ..:.|       |::.|.|..:|
  Fly   208 NGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLLDLNHRL---TAIYD-------IQVTLFMATLF 262

  Fly   154 ELSILVSTYVKLVDYSQWM-----SLLWIVSAIP--TFINTLDKIWFAVSLYALKE 202
            .::|:|...:.:.    |:     |||.|....|  ..||..| :|..::...|.|
  Fly   263 SVNIIVGHVLVIC----WINITRFSLLVIFLLFPQALIINFWD-LWQGIAFCDLAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 49/240 (20%)
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 53/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.