DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr22b

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:487 Identity:90/487 - (18%)
Similarity:174/487 - (35%) Gaps:127/487 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VQPLL--QQFQQLFFISKIAGILPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVVLYNILIYSFG 70
            ::|.|  |..:...:.|.:.||.|..|:..:....|.:||...:|.|  ::.|.:::.::..:|.
  Fly     8 IRPYLARQMLKTTLYGSWLLGIFPFTLDSGKRIRQLRRSRCLTLYGL--VLNYFLIFTLIRLAFE 70

  Fly    71 EEDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRN---QGRIGELYERIRLVD----ERLY 128
            .....|:|.:...  |:.:....||:|.::|..:....|   ..::||:...:.:::    |.|.
  Fly    71 YRKHKLEAFKRNP--VLEMINVVIGIINVLSALIVHFMNFWGSRKVGEICNELLILEYQDFEGLN 133

  Fly   129 KEGCVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTFINTLDKIWF 193
            ...|...|..:     |...:|::.:|....:....|......:.|: ::|.:..|...|:.:.:
  Fly   134 GRNCPNFNCFV-----IQKCLTILGQLLSFFTLNFALPGLEFHICLV-LLSCLMEFSLNLNIMHY 192

  Fly   194 AVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELGGMD 258
            .|.:..:......||..|::||           ...::.|..|.|:..|:.|    |||.|..::
  Fly   193 HVGVLLIYRYVWLINEQLKDLV-----------SQLKLNPETDFSRIHQFLS----LYKRLLELN 242

  Fly   259 IGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNN 323
                         :..|....:.|..|..|           .|:.|:|                 
  Fly   243 -------------RKLVIAYEYQMTLFIIA-----------QLSGNIV----------------- 266

  Fly   324 LCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKNPFITVI 388
                                 .|..|:.||..:.|..::.:       :.|:          :::
  Fly   267 ---------------------VIYFLIVYGLSMRTYSIFLV-------AFPN----------SLL 293

  Fly   389 VLSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVAD----DNLLYEIVNHLSLKLLNHSVDFS 449
            :..:....|:....|   |.:|...|.|.|.   :.:|    |:.|...||..:....:....|.
  Fly   294 INIWDFWLCIAACDL---TEKAGDETAIILK---IFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQ 352

  Fly   450 ACGFFTLDMETLYGVSGGITS--YLIILIQFN 479
            .||.|:  |....|....||:  ||:.|:||:
  Fly   353 LCGLFS--MNCRMGFKMIITTFLYLVYLVQFD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 85/469 (18%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 87/478 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.