DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr36b

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:472 Identity:88/472 - (18%)
Similarity:165/472 - (34%) Gaps:152/472 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KSRNGMIY--MLSTLILYVVLYNILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLT 105
            |||...||  |.:..||..::||...:  |:.:...:::.....:||   :...|| .:|:..:|
  Fly    35 KSRRCTIYAFMANIFILITIIYNFTAH--GDTNLLFQSANKLHEYVI---IIMSGL-KIVAGLIT 93

  Fly   106 ALRNQGRIGELYERIRLVDERLYKEGCVMDNSTIGRRIR--IMLIMTVIFELSIL-VSTYVKLVD 167
            .|....:.|::.:.::.| .|||     |.|..:...||  |:|...:.|.:.:| |:..|..:|
  Fly    94 VLNRWLQRGQMMQLVKDV-IRLY-----MINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALD 152

  Fly   168 ---YSQWMSLLWIVSAIPTFINTLDKIWFAVSLYALKERFEAINATLEELVDTHEKHKLWLRGNQ 229
               .::.|.||  |....:||..|......:.:..::.::..:||.|..:::...:         
  Fly   153 RQGTAEMMGLL--VKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRR--------- 206

  Fly   230 EVPPPLDSSQPPQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASR 294
                             |.:|                                            
  Fly   207 -----------------LSFL-------------------------------------------- 210

  Fly   295 KPPPPPLATNMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWS--------YPILSLMA 351
                           :|.|.|    .:...|.:.|::.:||:..::|.|        :.:..|||
  Fly   211 ---------------QLRNGA----FMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMA 256

  Fly   352 YGFLIFTAQLYFLYCATQYQSIPSLFR--------SAKNPFITVIVLSYTSGKCVYLIYLSWKTS 408
            |      ::.|.....|.|.|. |:::        |||...|..|:::        |.||....:
  Fly   257 Y------SEYYLSIVGTSYMSY-SIYKYGPHNLKLSAKTSIIVCILIT--------LFYLDALVN 306

  Fly   409 QASKRTGISLHK--CGVVAD--------DNLLYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYG 463
            ..:....:..||  .|::.:        |..|.|....|.|:|..:.:..:..|.|.:...:...
  Fly   307 CNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAA 371

  Fly   464 VSGGITSYLIILIQFNL 480
            :...:....|.||||::
  Fly   372 MCASVIVNSIFLIQFDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 86/468 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 88/472 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.