DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr59b

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:439 Identity:79/439 - (17%)
Similarity:145/439 - (33%) Gaps:169/439 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VVLYNILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLV 123
            |:||.:|  |.|..|.:.|..|..|                    ||..|.:.|.|  ::.|   
  Fly    84 VILYTVL--SRGFRDTAFKEMQPLL--------------------LTLFREEKRCG--FKGI--- 121

  Fly   124 DERLYKEGCVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTFI--- 185
                         ..:.|.:||:|.:. .|.||.|..|.|..:.||. .:|:| |:.:..|.   
  Fly   122 -------------GGVRRSLRILLFVK-FFTLSWLCVTDVLFLLYST-DALIW-VNVLRFFFKCN 170

  Fly   186 --NTLDKI--WFAVSLYALKERFEAINATLEELVDTH--EKHK----LWLRGNQEVPPPLDSSQP 240
              |.|:.:  .:.::|:.:...|:.:|..|:::|.:.  .||:    |||               
  Fly   171 TNNILEMVPMGYFLALWHIARGFDCVNRRLDQIVKSKSTRKHRELQHLWL--------------- 220

  Fly   241 PQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNM 305
                                                            :.|...|   ..|..|.
  Fly   221 ------------------------------------------------LHACLTK---TALNINK 234

  Fly   306 VHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQY 370
            ::..:: .|::.:..:|.:.|.:             |.      ..:.|.:.|...:.:|.:.||
  Fly   235 IYAPQM-LASRFDNFVNGVIQAY-------------WG------AVFTFDLSTPFFWVVYGSVQY 279

  Fly   371 QSIPSLFRSAKNPFITVIVLSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADDNLLYEIVN 435
            . :..|.....:....|.|..:.|.|      .||...:.:|.  ||.:         ::|  .|
  Fly   280 H-VRCLDYYLIDNMCDVAVEYHDSAK------HSWSEVRWTKE--ISSY---------VIY--AN 324

  Fly   436 HLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNLAAQQ 484
            ...|:|.       :||.|..:....:.:...:..|:::|:||:|..::
  Fly   325 STKLQLW-------SCGLFQANRSMWFAMISSVLYYILVLLQFHLVMRK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 76/431 (18%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 79/435 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.