DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr66a and Gr92a

DIOPT Version :9

Sequence 1:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:235 Identity:52/235 - (22%)
Similarity:76/235 - (32%) Gaps:85/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 LNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLI-FTAQLYFLYCATQYQSIPSLFRSAKNPF 384
            ||.:...|::        ..|| :.|....::.||| :....|.:              ||.|.|
  Fly   146 LNLISFAHEQ--------TYLW-FTIRKGFSWRFLIDWWCDFYLV--------------SATNIF 187

  Fly   385 ITVIVLSYTS--------GKCVYL---IYLSWKTSQASK----RTGISLHKCGVVADDNLLYEIV 434
            |.:..:.|.|        .|.||.   |.|....:..||    |....|.||      ..||..:
  Fly   188 IHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKC------ISLYREI 246

  Fly   435 NHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNLAAQ---------------- 483
            .|.|  ::.|.: |....|..|..:.|          ||.||.||:|.:                
  Fly   247 YHTS--IMFHKL-FVPLLFLALIYKVL----------LIALIGFNVAVEFYLNSFIFWILLGKHV 298

  Fly   484 --------QAKEAIQTFNSLNDTAGLVGAATDMDNISSTL 515
                    ..:.|:..|.::....|.||   |:....:||
  Fly   299 LDLFLVTVSVEGAVNQFLNIGMQFGNVG---DLSKFQTTL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 41/172 (24%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 52/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.