DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and ARF1

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_010089.1 Gene:ARF1 / 851335 SGDID:S000002351 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:98/179 - (54%)
Similarity:129/179 - (72%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLW-RMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLV 64
            |||..|:|: .:|||:|.:::|||||.|||||:||:..:.||:.|.||||.|||.|.::||.|.|
Yeast     1 MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTV 65

  Fly    65 WDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDL 129
            ||:|||..:|:.|..||.|||.||.|:||.||.|:...||.:.|||..::|..|:.||:||||||
Yeast    66 WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDL 130

  Fly   130 KGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIKN 178
            ..:||||||:.:|.|.||:...|.|||.||.:|||||:||||:...:||
Yeast   131 PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 94/172 (55%)
ARF1NP_010089.1 P-loop_NTPase 5..179 CDD:422963 93/173 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.