DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and trim23

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_005155659.1 Gene:trim23 / 767706 ZFINID:ZDB-GENE-060929-804 Length:576 Species:Danio rerio


Alignment Length:165 Identity:72/165 - (43%)
Similarity:110/165 - (66%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVWDLGGQQSLRAAWSTY 80
            |.::|.:|||.|||||||::...:|.:...||||.|||.|.::|:.|.:||:||:..||..|..|
Zfish   406 EIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHY 470

  Fly    81 YTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLT 145
            |.||:.|:.||||..|:||..:..||.::|..::|..|.||::|||||:.|::|..|::   :|.
Zfish   471 YLNTQAVVFVIDSCHRDRLMESHSELAKLLTEKELRDALLLIFANKQDVPGAVSVEEMT---ELL 532

  Fly   146 SIKK----HQWHIQACCALTGEGLYQGLEWIVQRI 176
            |:.|    ..||||.|.|.:|.||::||:|:.:::
Zfish   533 SLHKLCCGRSWHIQGCDARSGMGLHEGLDWLSRQL 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 72/162 (44%)
trim23XP_005155659.1 RING 33..76 CDD:214546
BBOX 127..170 CDD:237988
BBOX 175..221 CDD:197662
iSH2_PI3K_IA_R 228..372 CDD:304922
ARD1 408..576 CDD:206723 71/163 (44%)
Ras 408..567 CDD:278499 71/161 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.