DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl5b

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_083742.3 Gene:Arl5b / 75869 MGIID:1923119 Length:179 Species:Mus musculus


Alignment Length:176 Identity:127/176 - (72%)
Similarity:159/176 - (90%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            |||:.::||.:|.|:|||:::|||||||||||||||||||||||||||||||||:|.:|.|||:|
Mouse     1 MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMW 65

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |:|||:|||::|:|||:|||.:|:|:||.||||||:|:|||||||.||||.||::|::|||||:|
Mouse    66 DIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMK 130

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRI 176
            |.|:|||||:.|.|:|||.|.||||:|||||||||.|||||:..||
Mouse   131 GCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 123/171 (72%)
Arl5bNP_083742.3 Arl5_Arl8 3..175 CDD:133353 123/171 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838031
Domainoid 1 1.000 269 1.000 Domainoid score I1832
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2855
Isobase 1 0.950 - 0 Normalized mean entropy S312
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 1 1.000 - - otm42412
orthoMCL 1 0.900 - - OOG6_104179
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2407
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.