DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl5a

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_892039.1 Gene:Arl5a / 75423 MGIID:1922673 Length:179 Species:Mus musculus


Alignment Length:177 Identity:129/177 - (72%)
Similarity:157/177 - (88%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            ||:|.:|:||:|.::|||:::|||||||||||||||.|||||||||||||||||:|..|..||:|
Mouse     1 MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMW 65

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |:|||:|||.:|:|||||||.||:|:|||||||::|||||||:||.||||.||.||::|||||:|
Mouse    66 DIGGQESLRPSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVK 130

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIK 177
            ..|:.||||:.|.|||||.||||||||||||||||.|||||::.|:|
Mouse   131 ECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 125/171 (73%)
Arl5aNP_892039.1 Arl5_Arl8 3..175 CDD:133353 125/171 (73%)
Ras 18..164 CDD:278499 110/145 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 269 1.000 Domainoid score I1832
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100572
Inparanoid 1 1.050 283 1.000 Inparanoid score I2855
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1417432at2759
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 1 1.000 - - otm42412
orthoMCL 1 0.900 - - OOG6_104179
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2407
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.