DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and arl5c

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001037909.1 Gene:arl5c / 733518 XenbaseID:XB-GENE-5898153 Length:179 Species:Xenopus tropicalis


Alignment Length:176 Identity:117/176 - (66%)
Similarity:150/176 - (85%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVW 65
            ||.:.:|:..:|||:|||:::|||||||||||||||||||||||:|||||||||::.||.|||:|
 Frog     1 MGNIFTRIMSIFGNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTAPTIGSNVEEIISRNTHFLMW 65

  Fly    66 DLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLK 130
            |:|||::|||.|::||:|||.||:||||||||||..||||||:||.||:|..|::|::|||||:|
 Frog    66 DIGGQETLRATWNSYYSNTEFVILVIDSTDRERLPETREELYKMLAHEELKDAAILIFANKQDVK 130

  Fly   131 GSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRI 176
            .||:|:|||..|.|.:|:...||||.|||||||||..||:|:..|:
 Frog   131 DSMTASEISSSLALGAIRDRAWHIQGCCALTGEGLPAGLDWLKSRV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 114/171 (67%)
arl5cNP_001037909.1 Arl5_Arl8 3..175 CDD:133353 114/171 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1417432at2759
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.