DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl14

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_082119.1 Gene:Arl14 / 71619 MGIID:1918869 Length:192 Species:Mus musculus


Alignment Length:184 Identity:68/184 - (36%)
Similarity:113/184 - (61%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNEEHK---LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEV-VWRNIH 61
            ||||.|:      |.:.|   ::::|||:|||:|:||:....|.:.|.||||.|||.| :..::.
Mouse     1 MGLLNSK------NPQSKQAHILLLGLDSAGKSTLLYRLKFAETLSTIPTIGFNVEMVQLQSSLT 59

  Fly    62 FLVWDLGGQQSLRAAWSTYYTNTELVIMVID-STDRERLAVTREELYRMLQHEDLSKASLLVYAN 125
            ..|||:|||:.:|..|..|..|.:.::.|:| |..::||..:|:|...:|::|.:....:::.||
Mouse    60 LTVWDVGGQEKMRTVWDCYCENAQGLMYVVDCSEGKKRLEDSRKEFKHILKNEHIKNTPVVILAN 124

  Fly   126 KQDLKGSMSAAEISRQLDLTSI-KKHQWHIQACCALTGEGLYQGLEWIVQRIKN 178
            ||||.|::||.:|:|...:..: ....|::|.|||:|||||..|...:.:.:|:
Mouse   125 KQDLPGALSAEDITRMFKVKKLCSNRNWYVQPCCAVTGEGLDDGFRKLTEFLKS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 65/177 (37%)
Arl14NP_082119.1 SAR 1..176 CDD:197556 67/180 (37%)
ARLTS1 15..175 CDD:133356 60/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.