DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and zgc:110286

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001017602.1 Gene:zgc:110286 / 550265 ZFINID:ZDB-GENE-050417-68 Length:181 Species:Danio rerio


Alignment Length:178 Identity:84/178 - (47%)
Similarity:120/178 - (67%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLW-RMF-GNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFL 63
            ||...|:|: |:| |.::.:|||||||.|||||:||:..:.|||.|.||||.|||.|.::||.|.
Zfish     1 MGNFFSQLFSRLFEGKKQIRLVMVGLDAAGKTTVLYKLKLGEVVSTIPTIGFNVETVEYKNISFT 65

  Fly    64 VWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQD 128
            |||:|||..:|..|..||..::.:|.|:||:|.||:....|||..||..:::..|.|||.|||||
Zfish    66 VWDVGGQTKIRGLWKYYYQYSQGLIFVVDSSDHERIETAAEELNAMLAEDEMRDAVLLVLANKQD 130

  Fly   129 LKGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRI 176
            |..:|...|::.:|.|.::...||.:|:.||:.|.|||:||:|:..::
Zfish   131 LPKAMPVHELTDRLGLRALTGRQWFVQSTCAVQGSGLYEGLDWLSNQL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 82/173 (47%)
zgc:110286NP_001017602.1 P-loop_NTPase 1..181 CDD:304359 84/178 (47%)
SAR 3..175 CDD:197556 82/171 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.