DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and arl4c

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001016707.1 Gene:arl4c / 549461 XenbaseID:XB-GENE-998820 Length:193 Species:Xenopus tropicalis


Alignment Length:171 Identity:73/171 - (42%)
Similarity:103/171 - (60%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRN-------IHFLVWDLGGQQSLRAA 76
            :||:|||:|||||:||:...||.|:|.||||.|.|.:...|       .||  ||:|||:.||..
 Frog    16 IVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTERIRLSNGAAKGISCHF--WDVGGQEKLRPL 78

  Fly    77 WSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQ 141
            |.:|...|:.:|.|:||.|.:||...:.||:::.:..:.....|||.||||||..|::..||.||
 Frog    79 WKSYSRCTDGIIYVVDSVDSDRLEEAKTELHKVTKFAENLGTPLLVIANKQDLPKSLAVPEIERQ 143

  Fly   142 LDLTSIK-KHQWHIQACCALTGEGLYQGL----EWIVQRIK 177
            |.|..:. ...:|:|..||:.||||.:|:    |.|::|.|
 Frog   144 LALQELSPSTPYHVQPACAIIGEGLTEGMDKLYEMILKRRK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 71/167 (43%)
arl4cNP_001016707.1 Arl4_Arl7 11..193 CDD:206719 73/171 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.