DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl5c

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_038942559.1 Gene:Arl5c / 497990 RGDID:1563128 Length:221 Species:Rattus norvegicus


Alignment Length:158 Identity:94/158 - (59%)
Similarity:118/158 - (74%) Gaps:10/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVWDLGGQQSLRAAWST 79
            :.|||   .||.....|       ||||||..||||||||:|::..|||:||||||::||:.|.|
  Rat    67 QNHKL---HLDKTPSLT-------NEVVHTCSTIGSNVEEIVFQRTHFLMWDLGGQEALRSTWET 121

  Fly    80 YYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDL 144
            ||:|.|.||:|||||||.||:.:|||||::|.||.|..||:|::|||||:|.||:.||||:.|.|
  Rat   122 YYSNAEFVILVIDSTDRNRLSTSREELYKILAHEALQDASVLIFANKQDVKDSMTTAEISQFLTL 186

  Fly   145 TSIKKHQWHIQACCALTGEGLYQGLEWI 172
            ::||.|.||||.|||||||||..||:|:
  Rat   187 SAIKDHPWHIQGCCALTGEGLLAGLQWM 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 94/158 (59%)
Arl5cXP_038942559.1 P-loop_NTPase <79..217 CDD:422963 89/143 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1417432at2759
OrthoFinder 1 1.000 - - FOG0001602
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1008
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.