Sequence 1: | NP_648201.1 | Gene: | Arl5 / 38931 | FlyBaseID: | FBgn0035866 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245408.1 | Gene: | Arl4 / 43771 | FlyBaseID: | FBgn0039889 | Length: | 313 | Species: | Drosophila melanogaster |
Alignment Length: | 280 | Identity: | 75/280 - (26%) |
---|---|---|---|
Similarity: | 107/280 - (38%) | Gaps: | 119/280 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVW-----RNIHFLVWDLGGQQSLRAAWS 78
Fly 79 TYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLD 143
Fly 144 LTSI---------------------------------------------------------KKHQ 151
Fly 152 ----------------------------------------------------WHIQACCALTGEG 164
Fly 165 LYQGL----EWIVQRIK-NK 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arl5 | NP_648201.1 | Arl5_Arl8 | 3..175 | CDD:133353 | 71/273 (26%) |
Arl4 | NP_001245408.1 | P-loop_NTPase | 24..311 | CDD:304359 | 75/280 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45455874 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0070 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR11711 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |