DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl4

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:107/280 - (38%) Gaps:119/280 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVW-----RNIHFLVWDLGGQQSLRAAWS 78
            :||:|||:|||||.||:...::.::|.||||.|.|:|..     :.:||||||:|||:.||..|.
  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92

  Fly    79 TYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLD 143
            :|...|:.::.||||.|.||:...:.||.|..:..|.....:|:.||||||..:..|.|:.:.|.
  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157

  Fly   144 LTSI---------------------------------------------------------KKHQ 151
            |..:                                                         |.|.
  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222

  Fly   152 ----------------------------------------------------WHIQACCALTGEG 164
                                                                |:||..||:||||
  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287

  Fly   165 LYQGL----EWIVQRIK-NK 179
            |.:||    :.|::|.| ||
  Fly   288 LQEGLDALYDMILKRRKINK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 71/273 (26%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 75/280 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.