DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Sar1

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_732717.1 Gene:Sar1 / 42615 FlyBaseID:FBgn0038947 Length:193 Species:Drosophila melanogaster


Alignment Length:181 Identity:54/181 - (29%)
Similarity:85/181 - (46%) Gaps:16/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLVWDLGGQQS 72
            ||:..|    ||:.:|||||||||:|:....:::....||:....||:...|:.|..:||||...
  Fly    16 LWKKSG----KLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQ 76

  Fly    73 LRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAE 137
            .|..|..|:...:.::.:||:.||.|...::.||..:|..|.||...:|:..||.|..|:.|..|
  Fly    77 ARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDE 141

  Fly   138 ISRQLDLTSIKKHQWHIQ------------ACCALTGEGLYQGLEWIVQRI 176
            :.....|..:...:..:.            .|..|..:|..:|..|:.|.|
  Fly   142 LRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 52/178 (29%)
Sar1NP_732717.1 Sar1 2..192 CDD:206645 53/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.