DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and CG17819

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:173 Identity:56/173 - (32%)
Similarity:90/173 - (52%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNEEHKLVMVGLDNAGKTTI---LYQFLMNEVVHTSPTIGSNVEEVVW----RNIHFLVWDLGGQ 70
            |:::..|:::|||||||:|:   |.:....|    |....:.|.|  |    .|....:||:.|:
  Fly    17 GSQKSCLLILGLDNAGKSTLTDRLAEIFNGE----SKESNNQVSE--WSFTINNFRVQLWDINGE 75

  Fly    71 QSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDLKGSMSA 135
            ...|..|..||....::|.|:||||..||:..|..|..:|.|::|..|.||:.:||:|..||:|.
  Fly    76 LKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSM 140

  Fly   136 AEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIKN 178
            :.:...:.|..:....|..:.|...||.|:.:.:.||.::|.|
  Fly   141 STVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 54/168 (32%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 53/163 (33%)
Ras 23..183 CDD:278499 54/165 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.