DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and Arl2

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:180 Identity:73/180 - (40%)
Similarity:110/180 - (61%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWRMFGNE-EHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLV 64
            || .|:.|.:|...| |.:::::|||||||||||.:|....:...|||:|.|::.:........:
  Fly     1 MG-FLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNM 64

  Fly    65 WDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDL 129
            ||:|||:|||:.|..|:.:|:.::.|:||.||.||....:||..:||.|.|:.|:|||..|||||
  Fly    65 WDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDL 129

  Fly   130 KGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIKNK 179
            .|::|:.||...|.|..|..|.|.:....|:|||.|...::|::..|..:
  Fly   130 PGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 70/172 (41%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 70/171 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.