DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl5 and arf2a

DIOPT Version :9

Sequence 1:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_958912.1 Gene:arf2a / 399477 ZFINID:ZDB-GENE-040122-4 Length:181 Species:Danio rerio


Alignment Length:179 Identity:92/179 - (51%)
Similarity:130/179 - (72%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLLSRLWR-MFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNIHFLV 64
            ||.:.:.|:: :.|.:|.:::|||||.||||||||:..:.|:|.|.||||.|||.|.::||.|.|
Zfish     1 MGNMFAGLFKNLLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

  Fly    65 WDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASLLVYANKQDL 129
            ||:|||..:|..|..|:.||:.:|.|:||.||||:...||||.|||..::|..|.|||:||||||
Zfish    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDL 130

  Fly   130 KGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQRIKN 178
            ..:|:||||:.:|.|.|::...|:|||.||.:|:|||:||:|:..::||
Zfish   131 PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 88/172 (51%)
arf2aNP_958912.1 P-loop_NTPase 5..179 CDD:304359 88/173 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.